Recombinant Proteins

Descrizione Azione

The Guinea Pig CCL5 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Guinea Pig CCL5 applications are for cell culture, ELISA standard, and Western Blot Control. The Guinea Pig CCL5 yeast-derived recombinant protein can be purchased in multiple sizes. Guinea Pig CCL5 Specifications: (Molecular Weight: 7.9 kDa) (Amino Acid Sequence: SPYASDTTPC CFAYISRALP RTHIKEYFYT SSKCSNLAVV FVTRKNRQVC ANPEKKWVRE YINSLEMS (68)) (Gene ID: 100135495). For research use only. Made in the USA

Codice: RP0348GP-005
Dettagli

The Guinea Pig CXCL10 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Guinea Pig CXCL10 applications are for cell culture, ELISA standard, and Western Blot Control. Guinea Pig CXCL10 yeast-derived recombinant protein can be purchased in multiple sizes. Guinea Pig CXCL10 Specifications: (Molecular Weight: 8.6 kDa) (Amino Acid Sequence: IPHSRTIRCT CIETSTQPVN PKSFKKLEII PASQSCPRVE IIATMKMNGE KRCLDPESKV IKNLLKAVRK ERSKRS (76)) (Gene ID: 100714889). For research use only. Made in the USA

Codice: RP1194GP-025
Dettagli

The Guinea Pig CXCL10 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Guinea Pig CXCL10 applications are for cell culture, ELISA standard, and Western Blot Control. Guinea Pig CXCL10 yeast-derived recombinant protein can be purchased in multiple sizes. Guinea Pig CXCL10 Specifications: (Molecular Weight: 8.6 kDa) (Amino Acid Sequence: IPHSRTIRCT CIETSTQPVN PKSFKKLEII PASQSCPRVE IIATMKMNGE KRCLDPESKV IKNLLKAVRK ERSKRS (76)) (Gene ID: 100714889). For research use only. Made in the USA

Codice: RP1194GP-005
Dettagli

The Guinea Pig CXCL11 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Guinea Pig CXCL11 applications are for cell culture, ELISA standard, and Western Blot Control. Guinea Pig CXCL11 yeast-derived recombinant protein can be purchased in multiple sizes. Guinea Pig CXCL11 Specifications: (Molecular Weight: 8.5 kDa) (Amino Acid Sequence: FPMFKRGRCL CIGPGLRAVK VADIAKASII YPSNSCDKIE VIITLKAHKG QRCLNPRSKQ AGLIIKQVER KNSLKH (76)) (Gene ID: 100715176). For research use only. Made in the USA

Codice: RP2206GP-005
Dettagli

The Guinea Pig CXCL11 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Guinea Pig CXCL11 applications are for cell culture, ELISA standard, and Western Blot Control. Guinea Pig CXCL11 yeast-derived recombinant protein can be purchased in multiple sizes. Guinea Pig CXCL11 Specifications: (Molecular Weight: 8.5 kDa) (Amino Acid Sequence: FPMFKRGRCL CIGPGLRAVK VADIAKASII YPSNSCDKIE VIITLKAHKG QRCLNPRSKQ AGLIIKQVER KNSLKH (76)) (Gene ID: 100715176). For research use only. Made in the USA

Codice: RP2206GP-025
Dettagli

The Guinea Pig CXCL1 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Guinea Pig CXCL1 applications are for cell culture, ELISA standard, and Western Blot Control. The Guinea Pig CXCL1 yeast-derived recombinant protein can be purchased in multiple sizes. Guinea Pig CXCL1 Specifications: (Molecular Weight: 7.8 kDa) (Amino Acid Sequence: APAASELRCRCLRPVRGLHPKNIQSVAVTAPGPHCHQTEVLATLKDGREACLDEAPMVQKVLQRMLKGSKAT (72)) (Gene ID: 100135510). For research use only. Made in the USA

Codice: RP0363GP-005
Dettagli

The Guinea Pig CXCL1 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Guinea Pig CXCL1 applications are for cell culture, ELISA standard, and Western Blot Control. The Guinea Pig CXCL1 yeast-derived recombinant protein can be purchased in multiple sizes. Guinea Pig CXCL1 Specifications: (Molecular Weight: 7.8 kDa) (Amino Acid Sequence: APAASELRCRCLRPVRGLHPKNIQSVAVTAPGPHCHQTEVLATLKDGREACLDEAPMVQKVLQRMLKGSKAT (72)) (Gene ID: 100135510). For research use only. Made in the USA

Codice: RP0363GP-500
Dettagli

The Guinea Pig CXCL1 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Guinea Pig CXCL1 applications are for cell culture, ELISA standard, and Western Blot Control. The Guinea Pig CXCL1 yeast-derived recombinant protein can be purchased in multiple sizes. Guinea Pig CXCL1 Specifications: (Molecular Weight: 7.8 kDa) (Amino Acid Sequence: APAASELRCRCLRPVRGLHPKNIQSVAVTAPGPHCHQTEVLATLKDGREACLDEAPMVQKVLQRMLKGSKAT (72)) (Gene ID: 100135510). For research use only. Made in the USA

Codice: RP0363GP-025
Dettagli

The Guinea Pig CXCL1 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Guinea Pig CXCL1 applications are for cell culture, ELISA standard, and Western Blot Control. The Guinea Pig CXCL1 yeast-derived recombinant protein can be purchased in multiple sizes. Guinea Pig CXCL1 Specifications: (Molecular Weight: 7.8 kDa) (Amino Acid Sequence: APAASELRCRCLRPVRGLHPKNIQSVAVTAPGPHCHQTEVLATLKDGREACLDEAPMVQKVLQRMLKGSKAT (72)) (Gene ID: 100135510). For research use only. Made in the USA

Codice: RP0363GP-100
Dettagli

The Guinea Pig CXCL9 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Guinea Pig CXCL9 applications are for cell culture, ELISA standard, and Western Blot Control. Guinea Pig CXCL9 yeast-derived recombinant protein can be purchased in multiple sizes. Guinea Pig CXCL9 Specifications: (Molecular Weight: 12.0 kDa) (Amino Acid Sequence: TPVMRKGRCY CINSSDDVIS LKSLKDLKQF VPSPSCEKTE IIATKRNGDQ TCLNPDSTKV KKLIKQWEKK VTQKKKQKKA KKYQKNKKII KVKRSKAPCQ EKNT (104)) (Gene ID: 100714335). For research use only. Made in the USA

Codice: RP2166GP-005
Dettagli

The Guinea Pig CXCL9 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Guinea Pig CXCL9 applications are for cell culture, ELISA standard, and Western Blot Control. Guinea Pig CXCL9 yeast-derived recombinant protein can be purchased in multiple sizes. Guinea Pig CXCL9 Specifications: (Molecular Weight: 12.0 kDa) (Amino Acid Sequence: TPVMRKGRCY CINSSDDVIS LKSLKDLKQF VPSPSCEKTE IIATKRNGDQ TCLNPDSTKV KKLIKQWEKK VTQKKKQKKA KKYQKNKKII KVKRSKAPCQ EKNT (104)) (Gene ID: 100714335). For research use only. Made in the USA

Codice: RP2166GP-025
Dettagli

The Guinea Pig CXCL9 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Guinea Pig CXCL9 applications are for cell culture, ELISA standard, and Western Blot Control. Guinea Pig CXCL9 yeast-derived recombinant protein can be purchased in multiple sizes. Guinea Pig CXCL9 Specifications: (Molecular Weight: 12.0 kDa) (Amino Acid Sequence: TPVMRKGRCY CINSSDDVIS LKSLKDLKQF VPSPSCEKTE IIATKRNGDQ TCLNPDSTKV KKLIKQWEKK VTQKKKQKKA KKYQKNKKII KVKRSKAPCQ EKNT (104)) (Gene ID: 100714335). For research use only. Made in the USA

Codice: RP2166GP-100
Dettagli