The Swine IL-1 alpha yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine IL-1 alpha applications are for cell culture, ELISA standard, and Western Blot Control. Swine IL-1 alpha yeast-derived recombinant protein can be purchased in multiple sizes. Swine IL-1 alpha Specifications: (Molecular Weight: 18.1 kDa) (Amino Acid Sequence: SATYSFQSNM KYNFMRVINH QCILNDARNQ SIIRDPSGQY LMAAVLNNLD EAVKFDMAAY TSNDDSQLPV TLRISETRLF VSAQNEDEPV LLKELPETPK TIKDETSLLF FWEKHGNMDY FKSAAHPKLF IATRQEKLVH MAPGLPSVTD FQILENQS (158)) (Gene ID: 397094). For research use only. Made in the USA
The Swine IL-1 beta yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine IL-1 beta applications are for cell culture, ELISA standard, and Western Blot Control. The Swine IL-1 beta yeast-derived recombinant protein can be purchased in multiple sizes. Swine IL-1 beta Specifications: (Molecular Weight: 17.6 kDa) (Amino Acid Sequence: ANVQSMECKLQDKDHKSLVLAGPHMLKALHLLTGDLKREVVFCMSFVQGDDSNNKIPVTLGIKGKNLYLSCVMKDNTPTLQLEDIDPKRYPKRDMEKRFVFYKTEIKNRVEFESALYPNWYISTSQAEQKPVFLGNSKGRQDITDFTMEVLSP (153)) (Gene ID: 397122). For research use only. Made in the USA
The Swine IL-1 Receptor Antagonist yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine IL-1 Receptor Antagonist applications are for cell culture, ELISA standard, and Western Blot Control. The Swine IL-1 Receptor Antagonist yeast-derived recombinant protein can be purchased in multiple sizes. Swine IL-1 Receptor Antagonist Specifications: (Molecular Weight: 17.2 kDa) (Amino Acid Sequence: HPLGKRPCRM QAFRIWDVNQ KTFYLRNNQL VAGYLQGPNT KLEEKIDVVP VEPHFVFLGI HGGKLCLSCV KSGDEMKLQL EPVNITDLRK NSEQDKRFTF IRSDSGPTTS FESAACPGWF LCTALEADQP VGLTNTPKAA VKVTKFYFQQ DQ (152)) (Gene ID: 397499). For research use only. Made in the USA
The Swine IL-21 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine IL-21 applications are for cell culture, ELISA standard, and Western Blot Control. The Swine IL-21 yeast-derived recombinant protein can be purchased in multiple sizes. Swine IL-21 Specifications: (Molecular Weight: 15.0 kDa) (Amino Acid Sequence: HKSSFQGQDR LLIRLRQLID TVDQLKNYVH DLDPELLPAP EDVQRHCEQS AFSCFQKVEL KSANTGDNEK IINVLIKQLK RKLPPTNAGR RQKHGLTCPT CDSYEKKPIK EFLERLKSLI QKMIHQHLS (129)) (Gene ID: 403123). For research use only. Made in the USA
The Swine IL-22 Biotinylated yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine IL-22 Biotinylated applications are for cell culture. Swine IL-22 Biotinylated yeast-derived recombinant protein can be purchased in multiple sizes. Swine IL-22 Biotinylated Specifications: (Molecular Weight: 18.0 kDa) (Amino Acid Sequence: VPITHHCKLD QSNFQQPYIT NRTFTLAQEA SLADNNTDVR LIGNNLFQGV NMRERCYLVK QVLNFTLEEV LFPNSDRFHP YMQEVASFLD SLSKKLSQCR IKGDDQHIQR NVNNFKDTVK KLGESGEIKV IGELYLLFMA LKNECTLPGH SWKMDN (156)) (Gene ID: 595104). For research use only. Made in the USA
The Swine IL-22 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine IL-22 applications are for cell culture, ELISA standard, and Western Blot Control. The Swine IL-22 yeast-derived recombinant protein can be purchased in multiple sizes. Swine IL-22 Specifications: (Molecular Weight: 18.0 kDa) (Amino Acid Sequence: VPITHHCKLD QSNFQQPYIT NRTFTLAQEA SLADNNTDVR LIGNNLFQGV NMRERCYLVK QVLNFTLEEV LFPNSDRFHP YMQEVASFLD SLSKKLSQCR IKGDDQHIQR NVNNFKDTVK KLGESGEIKV IGELYLLFMA LKNECTLPGH SWKMDN (156)) (Gene ID: 595104). For research use only. Made in the USA
Lascia la tua email e seleziona le aree che vuoi seguire per ricevere novita di prodotto, approfondimenti tecnici e promozioni piu pertinenti.
Puoi scegliere le macro-aree Life Science e Diagnostica oppure le singole specializzazioni.
Seleziona uno o piu ambiti di interesse per ricevere comunicazioni piu utili e mirate.
Aggiornamenti su ricerca, strumentazione e applicazioni per il mondo Life Science.
Novita, approfondimenti e promozioni per laboratori diagnostici e flussi operativi.
2025 TEMA Ricerca - All Rights Reserved.
