The Bee Hymenoptaecin yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bee Hymenoptaecin applications are for cell culture, ELISA standard, and Western Blot Control. Bee Hymenoptaecin yeast-derived recombinant protein can be purchased in multiple sizes. Bee Hymenoptaecin Specifications: (Molecular Weight: 10.3 kDa) (Amino Acid Sequence: QERGSIVIQG TKEGKSRPSL DIDYKQRVYD KNGMTGDAYG GLNIRPGQPS RQHAGFEFGK EYKNGFIKGQ SEVQRGPGGR LSPYFGINGG FRF (93)) (Gene ID: 406142). For research use only. Made in the USA
The Bee MCDP yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bee MCDP applications are for cell culture, ELISA standard, and Western Blot Control. Bee MCDP yeast-derived recombinant protein can be purchased in multiple sizes. Bee MCDP Specifications: (Molecular Weight: 2.6 kDa) (Amino Acid Sequence: IKCNCKRHVI KPHICRKICG KNG (23)) (Gene ID: 406134). For research use only. Made in the USA
The Bee Melittin yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bee Melittin applications are for cell culture, ELISA standard, and Western Blot Control. Bee Melittin yeast-derived recombinant protein can be purchased in multiple sizes. Bee Melittin Specifications: (Molecular Weight: 2.8 kDa) (Amino Acid Sequence: GIGAVLKVLT TGLPALISWI KRKRQQ (26)) (Gene ID: 406130). For research use only. Made in the USA
The Bee Secapin yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bee Secapin applications are for cell culture, ELISA standard, and Western Blot Control. Bee Secapin Specifications: (Molecular Weight: 2.9 kDa) (Amino Acid Sequence: YIIDVPPRCP PGSKFIKNRC RVIVP). For research use only.
The Bovine Amphiregulin yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis Bovine Amphiregulin applications are for cell culture, ELISA standard, and Western Blot Control. Bovine Amphiregulin yeast-derived recombinant protein can be purchased in multiple sizes. Bovine Amphiregulin Specifications: (Molecular Weight: 10.2 kDa) (Amino Acid Sequence: SVRVEQVVKP KKNKTESEKT SDKPKRKKKG GKNGKNRRNR KKKNLCDTEF QNFCIHGKCT FLEQLETVSC QCYPEYFGER CGEKSMK (87)) (Gene ID: 538751). For research use only. Made in the USA
Annexins are important in various cellular and physiological processes such as providing a membrane scaffold, which is relevant to changes in the physical shape of the cell. Annexin proteins have been shown to be involved in trafficking and organization of vesicles, exocytosis, endocytosis and also calcium ion channel formation. Annexin proteins are not exclusively intracellular protein: Annexin proteins are also found in the extracellular space and have been linked to several processes fibrinolysis, coagulation, inflammation and apoptosis. Annexin proteins are all capable of binding negatively charged phospholipids in a calcium dependent manner and contain a 70 amino acid repeat sequence called an annexin repeat. Bovine Annexin V was produced in yeast and therefore does not have endotoxin, is naturally folded, and post-translationally modified. Bovine Annexin V Fluorescein has a predicted molecular weight of 36.1 kDa. Protien Sequence: MAQVLRGTVA DFPGFDERAD AETLRKAMKG LGTDEETILT LLTSRSNAQR QEIAVAFKTL FGRDLLDDLK SELTGKFEKL IVALMKPSRL YDAYELKHAL KGAGTDEKVL TEIIASRTPE ELRAIEQVYE EEYGSSLEDD VVGDTSGYYQ RMLVVLLQAN RDPDARIDEA QVEQDAQALF QAGELKWGTD EEKFITIFGT RSVSHLRRVF DKYMTISGFQ IEETIDRETS GNLEQLLLAV VKSIRSIPAY LAETLYYAMK GAGTDDHTLI RVVVSRSEID LYNIRKEFRK NFGTSLYSMI KGDTSGDYKK ALLLLCGGED D (321). Made in the USA
The Bovine APRIL yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine APRIL applications are for cell culture, ELISA standard, and Western Blot Control. The Bovine APRIL yeast-derived recombinant protein can be purchased in multiple sizes. Bovine APRIL Specifications: (Molecular Weight: 16.5 kDa) (Amino Acid Sequence: AVLTRKHKKKRSVLHLVPINITSKEDSDVTEVMWQPALQRGRGLEAQGYVVRVWDAGVYLLYSQVLFHDETFTMGQMVSREGQGRQETLFRCIQSMPSNPDWAYNSCYSAGVFHLHQGDILSVVIPRARAKLSLSPHGTFLGLVKL (146)) (Gene ID: 538567). For research use only. Made in the USA
The Bovine/Ovine/Caprine BAFF yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine/Ovine/Caprine BAFF applications are for cell culture, ELISA standard, and Western Blot Control. The Bovine/Ovine/Caprine BAFF yeast-derived recombinant protein can be purchased in multiple sizes. Bovine/Ovine/Caprine BAFF Specifications: (Molecular Weight: 17.1 kDa) (Amino Acid Sequence: ALQEAEETVT QDCLQLIADS DTPTIRKGAY TFVPWLLSFK RGRALEEKEN KILVKETGYF FIYGQVLYTD NTFAMGHLIQ RKKVHVFGDE LSLVTLFRCI QNMPETLPNN SCYSAGIAKL EEGDELQLAI PREDAKISRD GDGTFFGALK LL (152)) (Gene ID: 504507). For research use only. Made in the USA
Lascia la tua email e seleziona le aree che vuoi seguire per ricevere novita di prodotto, approfondimenti tecnici e promozioni piu pertinenti.
Puoi scegliere le macro-aree Life Science e Diagnostica oppure le singole specializzazioni.
Seleziona uno o piu ambiti di interesse per ricevere comunicazioni piu utili e mirate.
Aggiornamenti su ricerca, strumentazione e applicazioni per il mondo Life Science.
Novita, approfondimenti e promozioni per laboratori diagnostici e flussi operativi.
2025 TEMA Ricerca - All Rights Reserved.
