The Egyptian Rousette Bat IL-17A yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Egyptian Rousette Bat IL-17A applications are for cell culture, ELISA standard, and Western Blot Control. Egyptian Rousette Bat IL-17A yeast-derived recombinant protein can be purchased in multiple sizes. Egyptian Rousette Bat IL-17A Specifications: (Molecular Weight: 14.9 kDa) (Amino Acid Sequence: GIAIPRNTGC PNTEVKNFPQ SVKVNLNILN KDTDLRMSSN YCNRSTSPWT FHQNKDTERY PSVIWEAKCR HLYCVNAEGK VDHHLNSVPI QQEILVLRRQ PQHCPNSFQL EKMLVNVGCT CVTPIVRHMA (130)) (Gene ID: 107512115). For research use only. Made in the USA
The Egyptian Rousette Bat IL-1 beta yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Egyptian Rousette Bat IL-1 beta applications are for cell culture, ELISA standard, and Western Blot Control. Egyptian Rousette Bat IL-1 beta yeast-derived recombinant protein can be purchased in multiple sizes. Egyptian Rousette Bat IL-1 beta Specifications: (Molecular Weight: 18.4 kDa) (Amino Acid Sequence: SCTHDDGYVC DAPLRSLSFR LRDINQKSLV LSGPHELQAL HLNRQDASRQ VVFCMSFMPE ENGDKIPVAL GIKENNLYLS CVMKDGKPSL QLETVYLEDQ SKMDRRFVFN KTEIKGKVEF ESALYPSWYI STSQMEQMPV FLGSSRGGQD ITDFTMEVLS R (161)) (Gene ID: 107514950). For research use only. Made in the USA
The Egyptian Rousette Bat IL-6 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Egyptian Rousette Bat IL-6 applications are for cell culture, ELISA standard, and Western Blot Control. Egyptian Rousette Bat IL-6 yeast-derived recombinant protein can be purchased in multiple sizes. Egyptian Rousette Bat IL-6 Specifications: (Molecular Weight: 20.8 kDa) (Amino Acid Sequence: FPVPSGEDSK DDTNSNRPQP TSPNQTENLI KSIFLEISEV RNKMCGNDDS CKNSKEALTE NNLNLPKMVE KDGCFQSGFN QETCLKKITT GLLEFQIYLD YLQNKFEENA KAMQMRTKAL VQVLKQKVKN PDEITTPEPT TNSSLLAKLQ SQSEWLQTTT IHLILRSLED FLQFTQRSVR IM (182)) (Gene ID: 107518120). For research use only. Made in the USA
The Egyptian Rousette Bat M-CSF yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Egyptian Rousette Bat M-CSF applications are for cell culture, ELISA standard, and Western Blot Control. Egyptian Rousette Bat M-CSF yeast-derived recombinant protein can be purchased in multiple sizes. Egyptian Rousette Bat M-CSF Specifications: (Molecular Weight: 18.8 kDa) (Amino Acid Sequence: KEESKHCSYMIGDGHLQLLQQLIDSQMETSCPISFEFVDKERLKDPVCYVKKAFFLVQEIMEDTVRFKDNTSNAHAILKLQELSVSLEACFPKDFEEKDKACVGNFSESPLQLLEKIKNFFNETKNLLKKDRNIFSKNCSNTFAQCSSQSHKPERLEPWPHG (162)) (Gene ID: 107516132). For research use only. Made in the USA
Inserisci la tua e-mail e seleziona le aree di interesse per ricevere le ultime novità, approfondimenti e promozioni.
Seleziona uno o più ambiti di interesse per ricevere comunicazioni più utili e mirate.
2025 TEMA Ricerca - All Rights Reserved.
