The Egyptian Rousette Bat M-CSF yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Egyptian Rousette Bat M-CSF applications are for cell culture, ELISA standard, and Western Blot Control. Egyptian Rousette Bat M-CSF yeast-derived recombinant protein can be purchased in multiple sizes. Egyptian Rousette Bat M-CSF Specifications: (Molecular Weight: 18.8 kDa) (Amino Acid Sequence: KEESKHCSYMIGDGHLQLLQQLIDSQMETSCPISFEFVDKERLKDPVCYVKKAFFLVQEIMEDTVRFKDNTSNAHAILKLQELSVSLEACFPKDFEEKDKACVGNFSESPLQLLEKIKNFFNETKNLLKKDRNIFSKNCSNTFAQCSSQSHKPERLEPWPHG (162)) (Gene ID: 107516132). For research use only. Made in the USA
The Egyptian Rousette Bat TIM-3 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Egyptian Rousette Bat TIM-3 applications are for cell culture, ELISA standard, and Western Blot Control. Egyptian Rousette Bat TIM-3 yeast-derived recombinant protein can be purchased in multiple sizes. Egyptian Rousette Bat TIM-3 Specifications: (Molecular Weight: 17.2 kDa) (Amino Acid Sequence: SYVVEVGQNA YLPCSYMPAT SEDLVPVCWG KGSCPAFQCH SMVLNTDGRN VNYRTSRRYQ LKGNIHKGDV SLTIENVTLA DSGIYCCRIQ FSGPMNDEKS NLRLEVNPAK VTPAWTTRRD ITAAFPRLLT TEGHDSETQS METFHDRNHT QISTSANELQ DSGATTRI (168)) (Gene ID: 107521924). For research use only. Made in the USA
The Equine Amphiregulin yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine Amphiregulin applications are for cell culture, ELISA standard, and Western Blot Control. Equine Amphiregulin yeast-derived recombinant protein can be purchased in multiple sizes. Equine Amphiregulin Specifications: (Molecular Weight: 10.1 kDa) (Amino Acid Sequence: SIRVEQVVKP KKNKTESEKT SDKPKRKKKG GKNGKNRRNK KKKNPCDAEF QNFCIHGECK YIEHLEAVTC QCHQDYFGER CGEKSMK (87)) (Gene ID: 100050528). For research use only. Made in the USA
Annexins are important in various cellular and physiological processes such as providing a membrane scaffold, which is relevant to changes in the physical shape of the cell. Annexin proteins have been shown to be involved in trafficking and organization of vesicles, exocytosis, endocytosis and also calcium ion channel formation. Annexin proteins are not exclusively intracellular protein: Annexin proteins are also found in the extracellular space and have been linked to several processes fibrinolysis, coagulation, inflammation and apoptosis. Annexin proteins are all capable of binding negatively charged phospholipids in a calcium dependent manner and contain a 70 amino acid repeat sequence called an annexin repeat. Equine Annexin V Fluorescein has a predicted molecular weight of 36.0 kDa. Protein Sequence: MAQVLKGTVT DFPGFDERAD AEVLRKAMKG LGTDEESILT LLTSRSNAQR QEIAVAFKTL FGRDLLDDLK SELTGKFEKL IVALMKPSRL YDAYELKHAL KGAGTNEKVL TEIIASRTPA ELRAIKQVYE EEYGSNLEDD VVADTSGFYQ RMLVVLLQAN RDPDAGIDEA QVEQDAQTLF QAGELKWGTD EEKFITIFGT RSVSHLRRVF DKYMTISGFQ IEETIDRETS GNLEQLLLAV VKSIRSIPAY LAETLYYAMK GAGTDDHTLI RVVVSRSEID LFNIRKEFRK NFATSLYSMI KSDTSGDYKK ALLLLCGGED D (321). Made in the USA
Inserisci la tua e-mail e seleziona le aree di interesse per ricevere le ultime novità, approfondimenti e promozioni.
Seleziona uno o più ambiti di interesse per ricevere comunicazioni più utili e mirate.
2025 TEMA Ricerca - All Rights Reserved.
