The Canine IL-4 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Canine IL-4 applications are for cell culture, ELISA standard, and Western Blot Control. The Canine IL-4 yeast-derived recombinant protein can be purchased in multiple sizes. Canine IL-4 Specifications: (Molecular Weight: 12.8 kDa) (Amino Acid Sequence: HNFNITIKEI IKMLNILTAR NDSCMELTVK DVFTAPKNTS DKEIFCRAAT VLRQIYTHNC SNRYLRGLYR NLSSMANKTC SMNEIKKSTL KDFLERLKVI MQKKYYRH (108)) (Gene ID: 403785). For research use only. Made in the USA
The Canine IL-5 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Canine IL-5 applications are for cell culture, ELISA standard, and Western Blot Control. The Canine IL-5 yeast-derived recombinant protein can be purchased in multiple sizes. Chicken TNFSF15 Specifications: (Molecular Weight: 13.1 kDa) (Amino Acid Sequence: VENPMNRLVAETLTLLSTHRTWLIGDGNLMIPTPENKNHQLCIKEVFQGIDTLKNQTAHGEAVDKLFQNLSLIKEHIERQKKRCAGERWRVTKFLDYLQVFLGVINTEWTPES) (Gene ID: 403790). For research use only. Made in the USA
The Canine IL-6 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Canine IL-6 applications are for cell culture, ELISA standard, and Western Blot Control. The Canine IL-6 yeast-derived recombinant protein can be purchased in multiple sizes. Canine IL-6 Specifications: (Molecular Weight: 20.0 kDa) (Amino Acid Sequence: FPTPGPLAGDSKDDATSNSLPLTSANKVEELIKYILGKISALRKEMCDKFNKCEDSKEALAENNLHLPKLEGKDGCFQSGFNQETCLTRITTGLVEFQLHLNILQNNYEGDKENVKSVHMSTKILVQMLKSKVKNQDEVTTPDPTTDASLQAILQSQDEWLKHTTIHLILRSLEDFLQFSLRAVRIM) (Gene ID: 403985). For research use only. Made in the USA
The Canine IL-8 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Canine IL-8 applications are for cell culture, ELISA standard, and Western Blot Control. The Canine IL-8 yeast-derived recombinant protein can be purchased in multiple sizes. Canine IL-8 Specifications: (Molecular Weight: 8.6 kDa) (Amino Acid Sequence: VSSELRCQCIKTHSTPFHPKYIKELRVIDSGPHCENSEIIVKLFNGNEVCLDPKEKWVQKVVQIFLKKAEKQDP) (Gene ID: 403850). For research use only. Made in the USA
The Canine Leukemia Inhibitory Factor yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Canine Leukemia Inhibitory Factor applications are for cell culture, ELISA standard, and Western Blot Control. Canine Leukemia Inhibitory Factor yeast-derived recombinant protein can be purchased in multiple sizes. Canine Leukemia Inhibitory Factor Specifications: (Molecular Weight: 19.7 kDa) (Amino Acid Sequence: SPLPITPVNA TCATRHPCHS NLMNQIRNQL AQLNGSANAL FILYYTAQGE PFPNNLDKLC GPNVTDFPPF HANSTEKTRL VELYRIIAYL GASLGNITRD QKVLNPNALS LHSKLNATAD IMRGLLSNVL CRLCSKYHVA HVDVAYGPDT SGKDVFQKKK LGCQLLGKYK QVIAVVAQAF (180)) (Gene ID: 403449). For research use only. Made in the USA
Lascia la tua email e seleziona le aree che vuoi seguire per ricevere novita di prodotto, approfondimenti tecnici e promozioni piu pertinenti.
Puoi scegliere le macro-aree Life Science e Diagnostica oppure le singole specializzazioni.
Seleziona uno o piu ambiti di interesse per ricevere comunicazioni piu utili e mirate.
Aggiornamenti su ricerca, strumentazione e applicazioni per il mondo Life Science.
Novita, approfondimenti e promozioni per laboratori diagnostici e flussi operativi.
2025 TEMA Ricerca - All Rights Reserved.
